PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g55040.3.p
Common NameBRADI_2g55040, LOC100827463
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 481aa    MW: 51599.3 Da    PI: 6.4644
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g55040.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.27.1e-17151196147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       +g+W++eEd ll  +v+++G+++W++Ia  +  gR++k+c++rw + 
  Bradi2g55040.3.p 151 KGPWSPEEDALLSSLVTEHGPRNWTLIAGGIA-GRSGKSCRLRWCNQ 196
                       79******************************.***********985 PP

2Myb_DNA-binding55.11.7e-17203247147
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       r+++T+eEd ++ +a++ +G++ W++Ia+++  gRt++ +k++w++ 
  Bradi2g55040.3.p 203 RKPFTEEEDRIIMEAHAVHGNK-WASIAKHLV-GRTDNAIKNHWNST 247
                       789*******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.228146197IPR017930Myb domain
SuperFamilySSF466893.56E-29150244IPR009057Homeodomain-like
SMARTSM007174.4E-14150199IPR001005SANT/Myb domain
PfamPF002497.3E-16151196IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.7E-25152204IPR009057Homeodomain-like
CDDcd001675.95E-13153195No hitNo description
PROSITE profilePS5129428.229198252IPR017930Myb domain
SMARTSM007171.3E-16202250IPR001005SANT/Myb domain
PfamPF002499.0E-16203247IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-24205251IPR009057Homeodomain-like
CDDcd001671.61E-12205248No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 481 aa     Download sequence    Send to blast
MVSETAVSPQ PLSYPSAANS AHSSPTSPAD GTEAPAPPQL HPQPHHASPS PPPSMPGEKE  60
EAPVHPQPQP HHPPPSSSSS HSTADETQAP VPPPPQPEPH HPSPSSPSMA EMQAPVQPQP  120
QPNHSSPPPS GDDGDDVVFT GASAASGETV KGPWSPEEDA LLSSLVTEHG PRNWTLIAGG  180
IAGRSGKSCR LRWCNQLNPN VKRKPFTEEE DRIIMEAHAV HGNKWASIAK HLVGRTDNAI  240
KNHWNSTLRR RYCTGRKCTQ GSAVEQPTGE MSRAVLEKPR PLVEHSPFNA MEVKEAPVQK  300
LSGSCAMALQ IRDNNNCSTQ VVEQPYLVPV QAGSTSVALQ TRDHNNCITE VVDQPYLVQP  360
VAKVGAFRPY NQGPVQSTQK EMSSSTRSVS TLQALGADLT CFAADVPNKC GHGCCSAEER  420
PRNDSLLGPE FNEFEDHPPI QNSRFASLVS ELSSIAWMNS SLQTSDARNS LRHNQVSPIL  480
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A8e-401482514107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00337DAPTransfer from AT3G09230Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010232563.10.0PREDICTED: uncharacterized protein LOC100827463
TrEMBLA0A0Q3GJM00.0A0A0Q3GJM0_BRADI; Uncharacterized protein
STRINGBRADI2G55040.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55730.12e-68myb domain protein 109